PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010110423.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 273aa    MW: 31120 Da    PI: 8.8601
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010110423.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.5e-331872155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  XP_010110423.1 18 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 72
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4551575IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-321573IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-241873IPR006447Myb domain, plants
SuperFamilySSF466893.76E-161874IPR009057Homeodomain-like
PfamPF002498.0E-92071IPR001005SANT/Myb domain
PfamPF143792.8E-24120165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MERNFEYENG IVMTRDPKPR LRWTADLHDR FVDAVTKLGG PDKATPKSVL RLMGLKGLTL  60
YHLKSHLQKY RLGQQVRRQN SAEHSKESSG CSYAQFVNHS SGTTSTTSSR GDNKEHSEIP  120
IAEALRLQID VQKRLQEQLE VQKKLQMRIE AQGKYLQAIL EKAQNSLTLD MNGPGNLEVA  180
KAQLTDFNSA LSNFMENMNE VDQKSGIIEM NGVYRKESDT SFNIYQEGNR EKTDEDTKLK  240
ETIHFDLNTK GGFDFVSARG LDLEPKMLSY RRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010110423.10.0Myb family transcription factor APL
SwissprotQ9SAK52e-53APL_ARATH; Myb family transcription factor APL
TrEMBLW9S5990.0W9S599_9R
STRINGGLYMA09G34461.11e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-70G2-like family protein